PTM Viewer PTM Viewer

AT5G57540.1

Arabidopsis thaliana [ath]

xyloglucan endotransglucosylase/hydrolase 13

No PTMs currently found

PLAZA: AT5G57540
Gene Family: HOM05D000066
Other Names: AtXTH13; XTH13

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 284

MAAFTTKQSLLLLSLLLLISLSAGSFYDNFDITWGNGRANIVESGQLLTCTLDKISGSGFQSKKEYLFGKIDMKMKLVAGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVLHTNVFTGGKGNREMQFYLWFDPTADFHTYTVLWNPLNIIFLVDGIPIRVFKNNEANGVAYPKSQPMKIYSSLWEADDWATQGGKVKTDWTNAPFSASYKSFNDVDCCSRTSLLNWVTCNANSNSWMWTTLNSNQYGQMKWVQDDYMIYNYCTDFKRFPQGLPTECNLN

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000757 1 214
IPR010713 237 281
Molecule Processing
Show Type From To
Signal Peptide 1 24
Sites
Show Type Position
Metal Ion-binding Site 102
Site 100
Site 104
Active Site 104
Active Site 117
Active Site 127
Active Site 193
Active Site 198
Active Site 272

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here